DPCstruct | MC27981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 143 ± 19 aa |
| Standard deviation of domain lengths | 18.85 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09338 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7AN81 | 1-159 | ELCFAGVILNNESTMMADKRRGALYTKTLARMLGAEGAIISEEGGGNPETDLMLNCKNLEASGIKTVLVTDEYAGRDGRSQGLADVT… |
| A0A368Z0B0 | 20-118 | LNIINKDEDINLMGVIIVGTPQSQKEKYYVGKRAAQWAEAMQVDGAIVSADGWGNSDVDFANTIKEIAVRDIEVVGLSFIGIQGKFV… |
| A0A645FR54 | 1-137 | None |
| A0A2V7HQ99 | 515-673 | None |
| A0A1B2I777 | 293-439 | None |
| A0A428MVH1 | 386-541 | None |
| A0A1Y2MJ17 | 110-261 | None |
| A0A2V7DBG5 | 171-319 | None |
| A0A645GHI7 | 13-178 | None |
| A0A2V6WS46 | 74-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.