DPCstruct | MC27978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 101 ± 18 aa |
| Standard deviation of domain lengths | 18.27 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 68.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 40.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00741 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G9A8G9 | 12-110 | RAGYGAAPMNREPTNLGDILERVLDRGVVIAGDIRVNLLDIELLTIKLRLLIASVDTARELGIDWWQHDPWLSGRDRELVEENRRLR… |
| A0A2R6DGI0 | 14-82 | GPTRTQSDLADVVELLLDKGIVINADIAVSIGDAELLGIQLRAAIASFETAARYGLEFPTGTDTDRIEE |
| A0A7D5QFI2 | 1-86 | None |
| G9ERC1 | 5-105 | None |
| A0A1M3N8G6 | 1-92 | None |
| B1I4T0 | 5-88 | None |
| A0A7C6QRQ6 | 1-97 | None |
| A0A543MAG5 | 28-142 | None |
| D9X1N8 | 71-187 | None |
| A0A1H4AM86 | 2-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.