DPCstruct | MC27977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 118 |
|---|---|
| Mean domain length (aa) | 182 ± 39 aa |
| Standard deviation of domain lengths | 39.37 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.19 |
| Pfam Score | 97.04 |
| Assigned Pfam label(s) | CL0020- CL0196- CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067HDW3 | 4-185 | ECWGDEVSKKVLWQYKSLPKKGKPQGREVTVLAAFLISSPSKDLEVVALGTGTKCIGRSLLSPHGDIVNDSHAEIVARRALLRFFYT… |
| A0A0D3K942 | 8-131 | TDAAAIRLAVLDAYAALPATGKPQAGEWSVLAGIALRSASDALEVVALGTGTKCLTAKAIAAERSGGCLHDGHAEVCARRAFLRYLL… |
| A0A287X9M0 | 7-152 | None |
| A0A1S3MQ20 | 491-607 | None |
| A0A1S8W9D2 | 1-222 | None |
| A0A6P6BWM4 | 41-201 | None |
| A0A820HF06 | 1-166 | None |
| G0PFK5 | 31-201 | None |
| A0A7R9LBK9 | 7-181 | None |
| A0A4Z2HFH5 | 26-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.