DPCstruct | MC27972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Standard deviation of domain lengths | 9.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9QJU4 | 75-163 | AEPTDKEVLRMAIDTYGHDEQIRICQEEMNELGVAFSKYHREPNNRTWRAVQEELADVGIMLRQMAIMFSEEEINRIASEKIDRLKE… |
| A0A6A2RHF5 | 1-92 | MDKTERNAVWHESVERFGTRLQSVVCMEECAELIQAVSKRLRGKPDPEDNLAEEMADVYICLGMLRDMYGVTDERLESWIDRKTERQ… |
| A0A1H2TLZ9 | 47-150 | None |
| R5BT16 | 1-94 | None |
| A0A416CEN2 | 38-145 | None |
| A0A417JG58 | 1-114 | None |
| A7VTC2 | 1-106 | None |
| A0A3Q9SCD3 | 68-150 | None |
| A0A4R5B236 | 2-94 | None |
| J6HLC2 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.