DPCstruct | MC27970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 602 ± 82 aa |
| Standard deviation of domain lengths | 81.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07793 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7PNX4 | 14-516 | QQHWFSLASVYLHDQLRAVFDACEEELLQDGEQTVFCCELRRARRSFVDNYLNQLWLRCQNPTEVWVIGGSSAAPRARTLIYLTDAD… |
| A0A2U2N7I4 | 1-673 | MAPSDNVVYLGAGRSPRAALETLDALRGLASRELEGLLGRLFEEVDDAFFDRAERAGSDSEQQRYFVAMRQVRLGRPQIQTRFQEAL… |
| A0A2N6CVC9 | 118-712 | None |
| W5YM05 | 101-729 | None |
| A0A1S9CY75 | 62-734 | None |
| A0A0Q7ASQ2 | 2-641 | None |
| A0A2D9ZYD7 | 89-811 | None |
| A0A0A1H3I3 | 2-499 | None |
| A0A839A1Y4 | 16-523 | None |
| A0A5C8KR00 | 38-608 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.