DPCstruct | MC27968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 176 ± 27 aa |
| Standard deviation of domain lengths | 27.28 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02660 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V6PWY3 | 9-189 | LCGVIGYLLGSINTSVVTGKFYGVDVRQHGSGNAGATNTLRVLGKKAAIMVLIGDILKGLVTCVITNSIAGQTGAIVGGAAAIVGHN… |
| A0A3D5BBY2 | 19-206 | IPFGLVLTRLAGYGDIRKIGSGNIGATNVLRTGNKTLALLTVLLDAFKAGFAAYLAYRFTPNNEYYFLDYASHINTIASLTAGTCGI… |
| A0A2A4N468 | 46-170 | None |
| A0A1Z8XBY9 | 5-205 | None |
| A0A0U3DV81 | 15-181 | None |
| A0A6L7YKX8 | 69-254 | None |
| A0A7X7BSB7 | 4-116 | None |
| A0A7X3Y6N6 | 3-198 | None |
| A0A2E3DYD9 | 8-188 | None |
| A0A7V0T552 | 168-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.