DPCstruct | MC27963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 127 ± 20 aa |
| Standard deviation of domain lengths | 19.86 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.06 |
| Pfam Score | 93.28 |
| Assigned Pfam label(s) | CL0487- PF04189- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9PNW9 | 9-133 | CIQDGDVAIVYLGHESMTPVKVKRGAQTQTRYGVIRHSTDLIGQRYGSKVTCSKGGWVYVLHPTPELWTVNLPHRTQILYTTDIATI… |
| A0A4W5QEK1 | 1-112 | ASFIYSEFIQEGDVAIIILGHDSVMPVKVQQCSKTQTRHGVICHSKDLIGQRFGIMVTCSKGGWVYVLHPTNELWTLNLPHRTQILY… |
| A0A3Q0IVY2 | 3-108 | None |
| A0A445CI45 | 10-118 | None |
| A0A151BIP8 | 2-126 | None |
| A0A6A2XB60 | 1-125 | None |
| A0A0G4NMQ8 | 11-122 | None |
| A0A5J5X482 | 7-102 | None |
| A0A6A5QDA3 | 64-165 | None |
| F2DU43 | 26-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.