DPCstruct | MC27962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 66.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5QAN7 | 1-77 | MEYENRIRAYSTPDKIFRYFATLKIISEQGDAEIYMTPQDFVRSISPNEKQPENLGLDQFQVKRYDGKVSSAVWAGG |
| A0A1Y3BTL0 | 23-85 | EYENRIRHYSNPDKIFRYFATVKIIYNSKESEILMTPDDFLRALTPGIRQPEGLGLDQFKVID |
| A0A6A4VYZ3 | 89-144 | None |
| A0A6L5CQL9 | 252-324 | None |
| W5JSN3 | 184-239 | None |
| A0A443R8Z1 | 109-171 | None |
| A0A3Q3FA52 | 105-158 | None |
| F6VS94 | 124-188 | None |
| A0A6A5DZP5 | 299-361 | None |
| A0A2P8XIW3 | 152-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.