DPCstruct | MC27960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 314 ± 55 aa |
| Standard deviation of domain lengths | 55.43 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0HVM2 | 448-796 | TTRKEALSESIPYKYVVYKQKKKAYEYEYIYKLDSAQHKTNRCLFVTPRFLNDNGDWHQYDDIICAEPSKGVIQRLKETFWREQKRS… |
| A0A4W5Q1F6 | 18-332 | MMIPDRSKNEICSVPYKYFVYSKWNGKHYDHGTYEHIYQTNSRHIVNRCLSISQDLLTHEGEWHQYDDVIYPEPKQDLLSRVTNWFQ… |
| G1P6E6 | 145-391 | None |
| A0A6P4ZRB1 | 652-1052 | None |
| A0A5E4AKX5 | 1-265 | None |
| A0A6F9A6J3 | 371-716 | None |
| A0A3P8QPE0 | 403-624 | None |
| A0A493TPZ8 | 398-692 | None |
| A0A060ZEU7 | 1-386 | None |
| K7G6Q2 | 19-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.