DPCstruct | MC27947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 136 ± 15 aa |
| Standard deviation of domain lengths | 15.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15640 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1L984 | 1-111 | MDAARFARIKAAFERNGGVIDQSDEAQRLLKYHEAEAATLNAKTIVLKPNPTRAAIFEELIHTAQYRTGRATGANIIKMEIEAAKKL… |
| A0A4Z0NZ96 | 20-156 | SRRGYLDSPRLERRDIRRYSNVLESNFGISLEVMHKDSPVLQYMDENGMRAGFSSLHRKIYVRRAVTYYELVHEMKHAQHWANLGEQ… |
| E1III3 | 54-176 | None |
| A0A5B8TVV2 | 144-273 | None |
| A0A378RTG1 | 2-128 | None |
| A0A846WB26 | 28-178 | None |
| A0A519TGJ0 | 13-155 | None |
| A0A1G7PJQ5 | 87-235 | None |
| R5QG80 | 4-94 | None |
| A0A5C5SDH2 | 10-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.