DPCstruct | MC27941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Standard deviation of domain lengths | 10.84 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0143 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A249NI34 | 1-98 | MIGYVSDNLTHGYVPLNESGVVLTASVPANWRTATYSYYAVPVEGRDDQLLITSYITNRGEVAGKGMHATWAPSFLLQINPDNTTTV… |
| A0A4R4XNA8 | 30-123 | TAPTGLYGFAAPSLTGPYEPLNGSGLVIRNPAAEPDQAYAWLVLPDLHVVSFADYRSHQGRDLRHAKAAQARVDFGGTIAPMLKLTL… |
| A0A117PTQ1 | 91-175 | None |
| A0A6S6RWN1 | 79-172 | None |
| A0A6C1VV89 | 1-94 | None |
| V4YEH7 | 3-116 | None |
| F3Z128 | 398-525 | None |
| A0A3M3WMV4 | 98-196 | None |
| A0A0N0CQ12 | 593-695 | None |
| A0A0H3J1D5 | 390-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.