DPCstruct | MC2794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 83 ± 5 aa |
| Standard deviation of domain lengths | 4.62 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 37.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183FJ00 | 998-1080 | LEDDLSTHRVTATIPNLDSYPLRLRFQLSDMISEAGWMKHRHVGVWVPGTTHFLLLKTEAVEQDWAGRCLNITLQTFPWNGGS |
| A0A183F9E2 | 42-120 | VKNAEDDRDSHWLHGQIPNLRAFPLQILTTIPDMPSEAGWTKGRPVIAWIDGAPSLTHLKVHKVTVLPVQRELVVILVA |
| A0A7I4YNY4 | 5-89 | None |
| A0A183FJ58 | 192-273 | None |
| A0A183FCX6 | 18-99 | None |
| A0A0N4WCW7 | 119-200 | None |
| A0A7I4Z536 | 86-168 | None |
| A0A7I4Z399 | 55-129 | None |
| A0A7I4YMT3 | 321-406 | None |
| A0A183GA27 | 21-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.