DPCstruct | MC27939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 191 ± 37 aa |
| Standard deviation of domain lengths | 37.28 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3BHK2 | 2-237 | PKSPAKASSKTQTDTEYTFNFGRYNGETICAVPRDYIVWCKRNGLFKERPDLREGVRQYESLTLDQKEQLVKEKVSPWLWDACYDLI… |
| A0A2G8SMK1 | 392-582 | PPELQDRYVCESSILRDAKRDLAPWIWNACNAALDAVLLAGHVPLCAQDLTPEREAAMKCATSTFGASRQLYADRPNQPLGPSPSIL… |
| A0A164REP7 | 1-133 | None |
| V2WWS4 | 86-294 | None |
| A0A0H2RFJ0 | 309-493 | None |
| A0A0H2REP5 | 2-182 | None |
| A0A284QW83 | 65-208 | None |
| A0A4Y7T6P3 | 172-328 | None |
| A0A164REM9 | 258-394 | None |
| A0A2G8SMI7 | 95-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.