DPCstruct | MC27938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 294 ± 38 aa |
| Standard deviation of domain lengths | 37.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3D7R8 | 160-432 | IHSNLPHLFGMSSPDSERPFLVYDLDIMDHIEGVILSWMRQNVDEIMYMCAGMIHGISSALNSLSEQAGLFDMGTKNFDILWDARGR… |
| A0A2H3BBW8 | 10-268 | YMCARMIHGISSALSNLSEEARLFDLDVEDIDILWDARGRVVLAIHPEVANSSTTLASPEDHTSRLLRMMDDICINVFRSVNRIRYD… |
| A0A5C3LRK7 | 5-279 | None |
| A0A4V4HI99 | 67-342 | None |
| A0A2H3CGQ0 | 245-518 | None |
| A0A4S8M5X7 | 138-414 | None |
| A0A2H3BQY7 | 1-319 | None |
| A0A6A4IB73 | 181-525 | None |
| A0A2H3DXR9 | 2-211 | None |
| A0A067T2S9 | 336-668 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.