DPCstruct | MC27937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 326 ± 37 aa |
| Standard deviation of domain lengths | 37.11 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3B1T5 | 1-359 | MRASGVNIKAMYRMHKAKGVNKFLAASNLRHKDAELAEALFGTAHEDDESGGIHVEFQELVQFLNGEYIERYRKSYNTASDGKMNVK… |
| A0A1X6MHT3 | 3-250 | VSRQKAQLASKLDAVHTRWFELSANEENVTVFRLTQFFQTVTRVLELTEALSDKTAEAEMNVLKSDLQSMLNLISSGPDSSGETKPL… |
| M2P644 | 131-507 | None |
| F8P3B1 | 111-391 | None |
| A0A2H3CJT4 | 1-332 | None |
| A0A4Q2D184 | 135-474 | None |
| A8PAV6 | 137-476 | None |
| B0DR38 | 1-337 | None |
| A0A401GRG2 | 134-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.