DPCstruct | MC27936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 144 ± 10 aa |
| Standard deviation of domain lengths | 10.08 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3E341 | 121-247 | GDDSISTTFRERLKLLHGLCQVENTLSQMQKRVSTNPTDRVAGLAYLLYTKYIPAYDAEQSEESAWIALVNAILGDSRLNLLFCYPE… |
| A0A2H3AS09 | 1-150 | MDRIIAGDTPDGPMHARTIDEKGNYETELLTRFHKQLELLQRSRGLFNMLALMQKQVATNEVDRVAGLAFPLMLETIPAYHENESPE… |
| A0A2H3D0U5 | 55-196 | None |
| A0A284RX64 | 163-316 | None |
| K5VJX3 | 18-164 | None |
| A0A0H2RS31 | 255-397 | None |
| A0A284R8U0 | 932-1082 | None |
| A0A284R2P4 | 680-828 | None |
| A0A284QRZ4 | 600-739 | None |
| A0A284S7G6 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.