DPCstruct | MC27933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 164 ± 33 aa |
| Standard deviation of domain lengths | 32.96 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 49.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7I7M5 | 1-145 | SVRKEMLDLHYLALNQAKDYLAPGGSVLSTMGARVPLESFIKFGKDAGYLSEILLYKWKIQADAGEVIRDYAQKEKQGFGPFFFYDA… |
| A0A1V0Q2A2 | 25-179 | TKLGDGAEERDDDHIAHYYPWTDFDDFPFNAVGLGLNEALLRRLRSCAPGAEVILNFGARVGVPVLFDLFEANGYKPEKLQAQIVRQ… |
| A0A1D6FWK0 | 4-124 | None |
| A0A453HDX6 | 182-362 | None |
| A0A6V7P128 | 296-508 | None |
| A0A6P3Z3U0 | 183-365 | None |
| A0A2M9A534 | 1-221 | None |
| A0A5D2Q5V0 | 177-358 | None |
| A0A287SKZ6 | 1-119 | None |
| A0A287SKX6 | 5-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.