DPCstruct | MC27931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 231 ± 21 aa |
| Standard deviation of domain lengths | 21.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B6WHM1 | 76-321 | VTLRKATLASLMQSLSGESSNRVMWNDRYDTLLIARDPREIKNAIEKSVTDFGGLENYKELTGGADPFALMTPVCGLSANNIFKLMT… |
| A0A1V0PSI7 | 4-246 | VHEALRRCVLHAWTNLAGQQAFKNVAIDQNLIDWKIEGMATANEQISARLSCGDSANRMCEILSGSAMANIKSADNANAVDLSDDQR… |
| A0A510USL8 | 161-402 | None |
| A0A4Q6ACS9 | 18-271 | None |
| A0A6H1FVG6 | 8-244 | None |
| A0A3N2DP14 | 1-184 | None |
| A0A826P931 | 34-279 | None |
| I0QPG8 | 31-268 | None |
| A0A378IY79 | 222-426 | None |
| A0A6C0BJ73 | 49-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.