DPCstruct | MC27930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 246 ± 40 aa |
| Standard deviation of domain lengths | 40.32 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A315VK20 | 317-576 | QWFNMRAQNSLKPLSTDILDFFRALQQYLKSEEEGKEEVTLQLLLNLSAQCGVYFPSPSSSSSLHPHLPGSSVHSIHTIKDDSATEI… |
| A0A3Q2YEF5 | 3-212 | YLRSKEEGREDATLQLLLNLSSQRGICFPCTPSSSLSFAQHHLLATPFPLLHTIKDDSSSEIQVAWEDVRLQLRCYLLERLSTESQT… |
| G3HNV2 | 15-225 | None |
| A0A1L8I1Q9 | 21-294 | None |
| A0A2I0TSJ5 | 1-212 | None |
| A0A452TGS2 | 12-250 | None |
| A0A821EQQ9 | 66-275 | None |
| A0A091DYC5 | 29-324 | None |
| A0A3P9C8Q9 | 2-199 | None |
| A0A3Q3M2E0 | 92-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.