DPCstruct | MC2793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 121 ± 25 aa |
| Standard deviation of domain lengths | 24.50 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 70.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 46.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834IJU7 | 17-129 | RKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKTSLKNALQGFSPNHKITSFAEAKGLDAINERMPPRKD… |
| A0A0C2GGF3 | 30-127 | ILNEGRRGVQEGRHESETVLQLKGLNPGGKLPQGVLSGGKSALVETLSGVVPGHRIESFAEAKRLDQMNERMPPSMATPPGQSPSAS… |
| T1K363 | 119-231 | None |
| A0A7R9ADY6 | 70-182 | None |
| A0A0D8Y4K3 | 1-92 | None |
| A0A5N4DJY9 | 166-294 | None |
| A0A0C2MRG1 | 66-147 | None |
| A0A7M3VJE0 | 3-107 | None |
| A0A834AGW8 | 1-109 | None |
| A0A654H1I6 | 42-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.