DPCstruct | MC27928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 116 ± 6 aa |
| Standard deviation of domain lengths | 6.27 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9DRF6 | 2-114 | IKVLKLAGNYVPDEVVSCMIQLISSHAELQHYATVQLYRAVQTDIVNAQPLLQVAFWTIGEFGDIILRLNDDDVVKVEESSIIDVFE… |
| A0A315V2I3 | 1-133 | MQTQILQARLTVEHCSVGCAGGDVRDETVPNLIQLITNTSELHCYTVHKLYRELLTDISQQPLVQVACWCIGEYGDLLLKGECQETE… |
| R9PDI9 | 802-911 | None |
| A0A2I0TZZ1 | 317-433 | None |
| A0A5N5QBQ5 | 784-895 | None |
| A0A5N6KVB5 | 616-725 | None |
| A0A817J3T6 | 125-245 | None |
| A0A4S8J001 | 17-124 | None |
| A0A167F8Q4 | 434-542 | None |
| A0A0B1RXX8 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.