DPCstruct | MC27926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 98 ± 5 aa |
| Standard deviation of domain lengths | 5.46 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 54.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A315UT51 | 1-104 | MLENTAVRALKKLILLHREDGPSPSRTVEWLNMRSWCSGHLHLKCPRRVFSRRSPSKLREVYEKVFQKTADRHSDFSRLARVLTGNS… |
| A0A1B6CGR3 | 72-172 | QKELILLHKEGGERPNNTLTWLNMRTWVSSHHHIQCSKRMFIRRSQFRINELYSKVLMSEPNVHSDFSRLARWLTGTSVGLVLGGGG… |
| A0A6J2I7G5 | 65-160 | None |
| A0A3Q0J6C1 | 43-146 | None |
| A0A182U619 | 283-384 | None |
| A0A6S7GG17 | 67-160 | None |
| L5K9L1 | 640-735 | None |
| A0A673Y0H5 | 733-824 | None |
| A0A183KBF2 | 161-264 | None |
| A0A7R9EHE6 | 204-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.