DPCstruct | MC27915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 126 ± 11 aa |
| Standard deviation of domain lengths | 10.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.96 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 26.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L6LKH8 | 157-299 | PIHIISRGQPGGKGEPGERGRDGRAGTAGKACGDGGDGQPGGDGAPGGPGGSGGRGGSILVVYDSSGGERLLGRVLPESVGGAPGAG… |
| A0A2U1WII2 | 9-126 | SGTFIVRVIGGQGGDGGQGGAGGAGGSGGSGAAGGRGGTGGNGGQGGNGANGTAIVIKYDTMDPGTTVVFEDFGGLRGAGGASGAGG… |
| A0A6V8KZD4 | 72-192 | None |
| A0A0T9N9S9 | 1-131 | None |
| A0A2E2EHN6 | 33-143 | None |
| A0A2R7RGM9 | 1-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.