DPCstruct | MC27910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 128 ± 9 aa |
| Standard deviation of domain lengths | 9.18 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0I5K7 | 102-213 | RVTGNHASYINGTLHSSMPKADLYFLNPAGILFGPNARLSVSGSFHASTADYLRLGEDGRFDATHPEGSLLKVAPPRAFGFLNDSPA… |
| A0A844M5S3 | 55-182 | RVTGANRSEILGRLGVLGNANLFLINPNGIVFGQNASLDVEGSFVATTANAIRLGETGLFSASEPASGNLLSINPSALFYNVLAKEA… |
| A0A0S3TZU6 | 88-218 | None |
| A0A098TNE2 | 102-243 | None |
| A0A1D2PE19 | 1-120 | None |
| A0A1V1P5S5 | 75-203 | None |
| A0A2W1J990 | 122-248 | None |
| A0A1Z4LQU3 | 85-228 | None |
| A0A2W4RKU5 | 202-338 | None |
| A0A532CGN7 | 99-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.