DPCstruct | MC27908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 345 ± 53 aa |
| Standard deviation of domain lengths | 52.79 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 32.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04780 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1I738 | 60-423 | EFVRGLDAAIDKRACLHRPLGFADRAAQSFPNSAVIAAFRARLLFVLGEHDAAERECRRAIALENPRDPGDDCVPPGSISAPDVNAR… |
| A0A0D3HLK5 | 2-342 | DTAARTFDRSLVVALFRAKLLACLHDYDAAEAECRRALAVDNPDDPAAHEIPLGSAIGEEYDDMVSSLRKQLCDLQKKLVLLAVHDW… |
| A0A3L6SWL7 | 11-335 | None |
| A0A0P0Y416 | 224-586 | None |
| A0A1D6PR62 | 76-441 | None |
| A0A0D9XCH4 | 186-614 | None |
| A0A1Z5RJ69 | 180-584 | None |
| A0A287QMQ7 | 31-344 | None |
| A0A835ARE4 | 157-543 | None |
| A0A0E0J3K4 | 73-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.