DPCstruct | MC27907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 4.05 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 52.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0068 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6Q2XC26 | 1-66 | PHSSRVTIPRGFKDMLEGFCKAVVKYQPENIPAFAMSFFSVLVIFRDENPSMPIEELMKEFRATKG |
| M0R8P3 | 1-68 | MISSKPRLVVPYGLKTLLEGVSRAILKTNPTNITQFAAVYFKELIVFREGNSSLDIKDLIKQFHQMKV |
| A0A4W3GU39 | 1-75 | None |
| A0A151PHL7 | 5-78 | None |
| A0A151PH99 | 3-76 | None |
| A0A2Y9SHF6 | 1-68 | None |
| A0A4W5MA44 | 5-69 | None |
| A0A4W5L1K1 | 8-82 | None |
| A0A6F9B7G8 | 1-70 | None |
| A0A662YZD9 | 2-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.