DPCstruct | MC27904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 207 ± 16 aa |
| Standard deviation of domain lengths | 15.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 42.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4ZEK9 | 14-203 | LAVCLPMHAHASDLANDPFIRQVLDRQHFEPDGKYHLFGSRGELAERSGHIGLGKIQSHQLGNLMIQQAAIKGNIGYIVRFSDHGHE… |
| A0A1B8QHX3 | 2-219 | INIKLKKYIFIIFAFILSLIFSSVGYANIATDPFITKNTDKNTFEPGGRNHLFGSGRGVVSDRTGDISVVPTGNLQIGNLQIEQALI… |
| A9M496 | 2-201 | None |
| C6S4H2 | 1-170 | None |
| A0A450YN27 | 7-242 | None |
| A0A807DAY4 | 1-211 | None |
| D7N1R0 | 1-219 | None |
| A0A6G8J587 | 20-222 | None |
| A0A7H9WHF1 | 1-218 | None |
| A0A451AQY0 | 1-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.