DPCstruct | MC27900
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 169 ± 15 aa |
| Standard deviation of domain lengths | 15.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T1K7D4 | 1-182 | MANNYYDATGVLVLDQVTPVITALFGGLKLDASYPGNGEVYIAQIAEDSGAHWDDVCEDLVALAQSLGLSVPSEGPPTMDDVLAVLS… |
| A0A840HTC0 | 1-163 | MADYYTPTVVEPFIPLSAMLPIERLFLAQVFDEEIADETAYYYSEDGANDLIFMPVGDVRAALDAAKPDTSRLAQKLLEEQPDAILG… |
| A0A1A9GFP3 | 1-177 | None |
| A0A0W1CPC6 | 1-168 | None |
| A0A6B0DTF2 | 1-164 | None |
| A0A2A7SAD5 | 1-185 | None |
| A0A543QEW2 | 1-167 | None |
| A0A5C9CN64 | 327-512 | None |
| A0A522RDL4 | 1-182 | None |
| A0A2Z2Q2J8 | 46-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.