DPCstruct | MC2790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 258 ± 51 aa |
| Standard deviation of domain lengths | 51.30 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 14.98 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF02810- CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842J5C9 | 44-263 | QNKENKDVVEKIERKAKLVKAIVNFYGVISLEDIRMVLEKSLKSSIEAEELENFINNFYMIKGKLSYNEEKKLYTSLNVQDEQLDKI… |
| A0A5D0MIN7 | 4-195 | LTKYIVALTNLYGIVDKDKVVEIYNSQNEDQISTEDVEKFTMKPLKDVIASESVGVHKGYFAHEMILEFDEFDMLLGKKAGKPYYVP… |
| A0A847AWL2 | 31-292 | None |
| A0A845Q4H5 | 3-214 | None |
| A0A2K9AQ30 | 3-349 | None |
| A0A0F2PY05 | 99-422 | None |
| A0A4R6BHE6 | 103-326 | None |
| A0A421BG45 | 24-192 | None |
| A0A7W3UMB1 | 354-581 | None |
| A0A7C6CBG8 | 7-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.