DPCstruct | MC279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 215 ± 30 aa |
| Standard deviation of domain lengths | 30.18 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7VXQ8 | 1-213 | MILPIIVFGSGSYGNASTGSVEEEKSTRILDIRYGDPVGERYRTLTILSDGKVVRTLGGGNERGGAFERTDPPLVSPNGHFVFLTQV… |
| A0A173JAP4 | 4-178 | ATAWFTANGKTFPLFGADIGADGHSNMLSPDKKTLLLDPVIFGMLSDENGEEKLVSQQHCTVISMETGCVLADRSATFCVGQWKGNQ… |
| A0A5E6Y1B7 | 156-371 | None |
| A0A1G8DTU9 | 12-186 | None |
| A0A0G3X3I6 | 1-262 | None |
| A0A5E4W931 | 18-257 | None |
| A0A0F4PF96 | 33-207 | None |
| A0A1H5AUR3 | 122-359 | None |
| A0A2N7VCB1 | 31-283 | None |
| A0A6N4U224 | 10-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.