DPCstruct | MC27890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 137 ± 16 aa |
| Standard deviation of domain lengths | 16.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05782 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2PBZ5 | 1-122 | PPASPTTLNLGAICQKGHCRPRYLASFFPRSGASHFRRRGKAINRLESWYSLCCGKPEAQKLCCAQQAWKLALSQFCVEEFSTKTLA… |
| A0A553R2I0 | 19-178 | TLFSHLGRIRIDPEILLYSNFPPAEPDVSNLKSLCLYGNRRIRFTSESFSPNSKAYVQEAGKVLNRLESWFAHCCYGGFAEDDQAIL… |
| A0A6P3DYY3 | 167-283 | None |
| H2L3P1 | 3-112 | None |
| A0A1L8FBW7 | 22-161 | None |
| A0A836AM15 | 817-941 | None |
| A0A673HU83 | 10-160 | None |
| A0A498M7L3 | 40-194 | None |
| A0A498NE89 | 1-157 | None |
| A0A3B4V0A3 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.