DPCstruct | MC2789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 111 ± 16 aa |
| Standard deviation of domain lengths | 16.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 55.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10269 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9EGJ4 | 85-190 | ILSLIIHVLLLLFEILLCNNINEQKYSWILAFAPIYIISPLSIMFCIWELRHDRSVEFEMIFAVNILQFIFLSLKLDNIVEWSWVVV… |
| A0A183E3J3 | 9-109 | VLCCGEHALLTLFEALCCYKLQTNAAVDHLPWLLVFAPVFALSLLSVVVAIWAIRNDKCFELELFFSMNIVQFVFVAFKLDGVLDWH… |
| A0A6P9DFR1 | 85-190 | None |
| H0XFB1 | 76-182 | None |
| A0A2I2YWS9 | 1-88 | None |
| A0A452Q8T4 | 1-110 | None |
| A0A3P7RXE9 | 76-197 | None |
| A0A3P7H4F1 | 95-244 | None |
| A0A2Y9FD51 | 85-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.