DPCstruct | MC27889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 183 ± 43 aa |
| Standard deviation of domain lengths | 42.54 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 68.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0644 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553R0A7 | 22-165 | DIKEKLKESRRFWSSLPDRVCSEEGVGDPEEEHCWNSHTKGRYFPEVVRDGLTQQLNNPEVEVDIMRPDSFIRQQIMTLRVMSNKLR… |
| A0A0P7YWA6 | 1-122 | MCRFCASFCQVVDIKEKLKQSKKFWSTLPDGICKEDKVTASTANEEQCWNGHAKGRYFPEVSKDGLANQMNNPEVEVDITRPDTFIR… |
| A0A482WSX6 | 422-573 | None |
| C3ZEX7 | 2-159 | None |
| A0A4Y2CRX8 | 36-215 | None |
| B4HDB1 | 115-321 | None |
| T2M2P4 | 281-595 | None |
| A0A2I0TUN5 | 103-318 | None |
| A0A164YYK2 | 684-939 | None |
| S4RSY8 | 2-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.