DPCstruct | MC27886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 238 ± 61 aa |
| Standard deviation of domain lengths | 61.16 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 76.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A164YJP6 | 1-202 | MDTDVSRWLLDFLVRQPISDSNLTSLLSSLPLSDTDSNLKKLLLLRKLDSQISTPTQHLLLLLEQIEELDHRENVTTVESMKRAYCA… |
| A0A118JXA5 | 1-228 | MDIDVSGWILEFLLRQTSVDDHTLDELIRVLPLPDHNLSLKKSLLLRKIESDILKGTVSEPVLELLETIQELDQKEGVVEVPETMKT… |
| A0A2P6PD42 | 3-212 | None |
| A0A833RAP5 | 2-207 | None |
| A0A0G2KRV3 | 1-306 | None |
| A0A6N2LYH3 | 10-226 | None |
| A0A1S3ZJ90 | 1-215 | None |
| A0A2P5F5I9 | 3-178 | None |
| K2GYJ0 | 50-453 | None |
| B0EC69 | 52-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.