DPCstruct | MC27880
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 220 ± 49 aa |
| Standard deviation of domain lengths | 48.92 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.27 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | CL0010- PF17846- CL0280- PF13966 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0MJE7 | 19-209 | HGKAKYYSTKLYANNQDDIDNIAIEYITGMIWIYNYYINGRTDWQWVYPYHFAPFVADLAKVVRANFSLKRGSPLHPFEQLLVVIPP… |
| A0A671WIX2 | 8-190 | QYKRTYYMTKMGVDVVSDEFLAKQARCYVEGIQWILHYYYHGVQSWSWYYPFHYAPFLSDIRNIAGLKLTFDLGKPFMPFQQLLAVL… |
| A0A7S3LM48 | 4-250 | None |
| A0A6A2YY49 | 70-307 | None |
| A0A6P3Z399 | 241-505 | None |
| A0A1D6GFN1 | 82-349 | None |
| A0A2D4PFY4 | 148-413 | None |
| A0A834TB40 | 127-375 | None |
| L1LER9 | 865-1031 | None |
| A0A6V7PXW2 | 89-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.