DPCstruct | MC2788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 142 ± 12 aa |
| Standard deviation of domain lengths | 12.25 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 44.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15477 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8LJX7 | 134-272 | QAAATAAAAAMQAKVLAQTGIAVPSYYNPLAINPMQYAEQIKKRKMLWSKKEEVEVPAASSNKWESTTFESGSTQEKFRRLMGIKGE… |
| A0A2K6FVP1 | 23-162 | KEMIAVAAQMAALQAKALAETGIAVPSYYNPAAVNPMKFAEQEKKRKMLWQGKKEEDKSQSAEIWEKLNFGNKDQNVKFRKLRSIKS… |
| A0A813M803 | 186-313 | None |
| A0A6P4YAT6 | 534-661 | None |
| A0A812BNJ6 | 450-591 | None |
| A0A7J7J4K4 | 5-118 | None |
| T1JJR2 | 4-157 | None |
| A0A7I8VY99 | 153-296 | None |
| A0A814M4F0 | 3-130 | None |
| T1EZ08 | 177-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.