DPCstruct | MC27878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 776 |
|---|---|
| Mean domain length (aa) | 264 ± 55 aa |
| Standard deviation of domain lengths | 55.36 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 16.13 |
| Pfam Score | 98.23 |
| Assigned Pfam label(s) | CL0041- PF04574- CL0063- CL0110- CL0093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L0E3Y4 | 3-225 | DFKMARRWLDSADAILISASNGLSITEGYNIFAYDQAFKDHFQQFHNQYGFMNILQGLTYQFPTPEERQVFYSAIFDYMVNNYQVSP… |
| T0L6G6 | 9-290 | IQSNIHKFINKNVVIITGAGISVKAGIPDFRSKTGIFSDIYKKFKIKGEDLFTYKFGLNDSTRHIYINYIYNLKKLIDNAKPTFTHN… |
| A0A1Y2HEW2 | 6-261 | None |
| A0A820BKE0 | 7-247 | None |
| A0A820BUS7 | 270-478 | None |
| A0A1Q7CNF1 | 3-200 | None |
| B0EBU9 | 14-268 | None |
| Q0YQN8 | 10-351 | None |
| A0A653WM81 | 3-201 | None |
| G9PL31 | 4-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.