DPCstruct | MC2787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 4.53 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1PHJ6 | 1-71 | MASVSYQIAHLLEKMTSNDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMLLRLLEDKNGEVQNLAVKC |
| A0A2K6FT24 | 1-75 | MSAAAFHISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVVKMLLRLLEDKNGEVQNLAVKASVFQ |
| A0A2R7W2Z1 | 1-71 | None |
| A0A1I8C3L1 | 3-73 | None |
| A0A5N5SIQ2 | 1-68 | None |
| A0A484MQN5 | 2-76 | None |
| A0A5B7JIM6 | 1-56 | None |
| A0A287QCI6 | 2-69 | None |
| A8IDU2 | 2-69 | None |
| A0A4V1J0R6 | 235-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.