DPCstruct | MC2786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 169 ± 29 aa |
| Standard deviation of domain lengths | 28.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 35.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04668 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0J610 | 3-123 | DLAQLQRKSHAEEFEGAPALFRAMASSPNDGYTYNWSVVSFPTDDYDSYDPSESQVNCTVLYLDQCTSWNKCRQTCLKTGATSYRWF… |
| A0A2K6FEK2 | 21-189 | PVSLSCNKALCASDVSKCLIQMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVN… |
| A0A0R3QPJ2 | 111-233 | None |
| A0A0M4EZN5 | 20-180 | None |
| A0A5S6QTT6 | 17-166 | None |
| A0A7R9L7D3 | 52-228 | None |
| A0A6P8HFT6 | 43-197 | None |
| K1PTI3 | 391-572 | None |
| A0A484B3T4 | 566-734 | None |
| B4J1H8 | 25-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.