DPCstruct | MC27853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 5.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10946 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E6X734 | 1-82 | MKTLSELIHTEDPGWELISEWIKEATNKLEILPKNKEEADNALYLTQVTTRSPMGAILHETGGILVDHGWIRILGSGHIKLN |
| A0A2V0QZW2 | 72-149 | MKELKDLVDHREPALPLVEEMLADASVNYQLLPSSAESSRVLTRLQVTTRSTLGTIAYHTGGLLIDHGWLRVLGSGHP |
| A0A519TJK2 | 4-81 | None |
| A0A841EBI9 | 1-69 | None |
| A0A8B3U6J8 | 1-79 | None |
| A0A2M9L4F7 | 1-76 | None |
| A0A066YL94 | 3-67 | None |
| S3Y4A2 | 4-80 | None |
| A0A7W8QQ62 | 5-80 | None |
| A0A1B9AIK2 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.