DPCstruct | MC27852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 137 ± 11 aa |
| Standard deviation of domain lengths | 11.36 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E6X3X4 | 1-145 | MKLSTLFTVGLLFLGINAAIARVGIPIPYGDEDKIIKILDLPDTEEFQLEDGTYFDIGKMYTISHIVWLPYSNTEVVITGYVDDDTY… |
| A0A3M7L7R9 | 7-131 | KAKIPVCLPCEKIQPIQELPTDSEIQKLVGQKVNLSYINTEYGILWMSIWNTNGRYVLSDISNNSYFEIDTQEAKILKEKHDFDVTT… |
| W0F2W8 | 2-153 | None |
| A0A6L7K9N6 | 21-146 | None |
| A0A848Y0A3 | 1-147 | None |
| A0A2W5FF02 | 10-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.