DPCstruct | MC2785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 122 ± 11 aa |
| Standard deviation of domain lengths | 10.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 62.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7TTN0 | 321-422 | LGVLQECGGRMYMDEKDYNAAIQAFFSSFKCYDEAGDPRRFTLLKYLVLASMLHASTIDPFDSQEAKPYKEEREVVAMRNLILAFQN… |
| A0A7R8XFK1 | 238-358 | MGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQN… |
| A0A0J7K4U3 | 1-133 | None |
| A0A016WE95 | 234-354 | None |
| A0A4Y7M4H6 | 110-244 | None |
| A0A7J6TER3 | 85-221 | None |
| A0A2G5VTW2 | 2-111 | None |
| A0A364LAI7 | 222-341 | None |
| A0A183BQE5 | 502-622 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.