DPCstruct | MC27848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 123 ± 14 aa |
| Standard deviation of domain lengths | 13.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A7I2N4 | 1-129 | MITIDELKAMPLDEPIGEDVVDAIETMAGDGLRKLIRERFKPYEGVYRIDAMGEYVSEKDWKKFWSALPGWCEQVFMLHNNAHSADY… |
| A0A366KCS6 | 1-143 | MRCWFGYLLGVLTIPACSLLTVAVLAKAGRGRVSERHIEGLYKAVDDRLLPECRSDGFRPGEGIYRLGDYGAVTVDQWDQAMEQSGA… |
| A0A1Y3S1G6 | 147-261 | None |
| A0A7X9NSG0 | 2-118 | None |
| A0A2N3QMK2 | 128-277 | None |
| A0A5M9ZIQ5 | 2-105 | None |
| A0A1Y3UDC7 | 3-110 | None |
| A0A4P6DTQ1 | 78-197 | None |
| A0A2N3QNB7 | 22-144 | None |
| A0A087AQH0 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.