DPCstruct | MC27846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 94 ± 7 aa |
| Standard deviation of domain lengths | 6.96 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 22.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I7NC59 | 6-103 | EVSLAWDLLELATQYVSPDTRAWLCAHIGAGELDTAIRRVLSCLASHKAHVPQNVVADLQNWLAGYKGGARENMLRVLIAQLRVSAP… |
| A0A429DI37 | 103-189 | RISFFGDSLLDQIGDRIAPDLLAFYRTLHWSGEWEELADVLVAHAMHENLHLGVDEYATLDSLLNSFDLPIDGFLYLNDRAHALAVL |
| A0A4P7H7T5 | 3-93 | None |
| A0A840QBC5 | 1-97 | None |
| A0A1H3RQ39 | 2-99 | None |
| A0A1Y0C6R7 | 16-101 | None |
| A0A1A2G478 | 1-91 | None |
| A0A543GHY6 | 2-105 | None |
| A0A7K1UT34 | 23-127 | None |
| A0A220Y433 | 62-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.