DPCstruct | MC27843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 80 ± 13 aa |
| Standard deviation of domain lengths | 13.38 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 55.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06844 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S5C2E7 | 3-64 | LADFCRNCLAKWYSAAASEQGADIDYEAAREVVYKMPYSEWKEKHQLPATDEQLEKLAARQE |
| A0A7Y9P8K4 | 4-89 | IDPRTQTELEAAVFRRLVAHLRNRTDVQNIDLMNLAGFCRNCLSNWLKDAADETGVALTKDESREAVYGMPYAEWKARFQTEATPQ |
| A0A357CLA8 | 242-325 | None |
| A0A836Q7W8 | 1-62 | None |
| A0A2G1YZ05 | 5-92 | None |
| A0A655PLM3 | 2-81 | None |
| A0A501XJ41 | 2-96 | None |
| A0A7S3SNW9 | 41-133 | None |
| A0A537M358 | 1-78 | None |
| A0A1M3A9A4 | 265-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.