DPCstruct | MC27841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 127 ± 23 aa |
| Standard deviation of domain lengths | 22.76 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.39 |
| Pfam Score | 99.39 |
| Assigned Pfam label(s) | CL0346- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1EH42 | 2-97 | LTAFFDTKENWEETSIVVGRPWKKDELRLKSNSDLHKLWYVLLKERNMLMTMEAEYNRQCELFPSPERLEKVEESMENILDVVRERN… |
| A0A2R5GKS1 | 6-128 | RAAGALAGRRPTVGARPAAVTRGIEEFFDVRGEKSTDGTVETGRAWTADELRLKSFDDLRKLWFILLKEKNMLLTEKHLARSMGQPM… |
| T1PAG3 | 2-89 | None |
| A0A6L5CLE2 | 16-98 | None |
| A0A177B4N4 | 16-125 | None |
| M1VHF1 | 36-176 | None |
| F4Q5W8 | 18-152 | None |
| A0A835JFB5 | 223-383 | None |
| A0A7S4PGW4 | 1-112 | None |
| A4RHR8 | 97-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.