DPCstruct | MC2784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 82 ± 3 aa |
| Standard deviation of domain lengths | 3.37 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5U3V2 | 177-258 | IRLLEQVDLKRFDNSKESPKFHYWKIHYSTTSCHHWWKSDQFSSEFYMVRDTDGVVASISVTPYSFNFGVWKMTETELFDRM |
| A0A2G5VUJ0 | 92-173 | RDQILNAIGTKYIDGTKTPPTHTLPQIYIEYPDAEPFTEPITSYAYVVRESDNWVASVEILGKKFSFGVWNKTENEFLGMMD |
| A0A2G5U1Y8 | 143-226 | None |
| A0A2G5UQS2 | 1-88 | None |
| A0A2G5U6C4 | 52-137 | None |
| A0A6A5HTV3 | 871-947 | None |
| A8Y1U4 | 585-665 | None |
| A0A2G5UXD4 | 391-469 | None |
| A0A2G5VGW3 | 107-193 | None |
| A0A2G5UST5 | 250-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.