DPCstruct | MC27838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 399 |
|---|---|
| Mean domain length (aa) | 194 ± 27 aa |
| Standard deviation of domain lengths | 27.40 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.65 |
| Pfam Score | 90.61 |
| Assigned Pfam label(s) | PF04526- CL0559- CL0328- CL0219- CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3YPW2 | 3-149 | SWGIVIPIGAMVARYLRQYDPIWFYSHTTIQSLGFLLGFAGIICGFILEDRLSVDVDRHKALGIFILVLGCLQVIAFLARPGKESKM… |
| A0A2R5GB27 | 456-637 | FGSWMISAPKQLGIHGILMVLAWIFLIPGGTVPPLLFKHKEGNKWFLAHKSMMGLGIVFTLVAFFLIVPYKWGDNFGTTHGKIGLTI… |
| A0A803Q3H1 | 2-145 | None |
| A0A226EV45 | 625-846 | None |
| A0A530H5B4 | 3-202 | None |
| A0A0G4HMB7 | 174-362 | None |
| A0A1Y2H7Z4 | 22-219 | None |
| A0A1J7IB61 | 2-180 | None |
| A0A6A6KWW9 | 62-196 | None |
| A0A066VVS5 | 2-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.