DPCstruct | MC27834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 136 ± 9 aa |
| Standard deviation of domain lengths | 8.74 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C6IC06 | 137-271 | RRPKDLLRGRNANGELEFGHWVNSVFRPYDDRAAIDGGSLEGKGLELAWLKSPLDLFLLQTQGSGRLRLQDGGEMFVGYDGRNGQPY… |
| M3IAW0 | 1-131 | METPSDLIVKKDGNKKSVGKIINEVFVPYETREELSHTSVWKKRSKAIVYVKIVDLHLAQLEGSALVKVPDHIPFRITYSEDNGKEY… |
| A0A3E0NMD3 | 350-490 | None |
| A0A6S7CLX0 | 50-192 | None |
| A0A379GB30 | 1-145 | None |
| A0A2T4JJ96 | 93-205 | None |
| A0A7R9RB40 | 142-271 | None |
| A0A7C5DR99 | 6-147 | None |
| A0A1M7ZJC8 | 166-307 | None |
| A0A812QW33 | 327-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.