DPCstruct | MC27833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 145 ± 11 aa |
| Standard deviation of domain lengths | 10.82 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 15.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G3QGQ4 | 26-181 | ETAKRILKGEFTDIIVIKGRFKDGLEENFGLFLVFISRITRAVVASRSVISHTASVFHHKPFDNWKNFFSKLEREISEADVDTEKME… |
| M3I2D2 | 3-136 | SNQVYTFQFISKDTSLSVHILFTSVIDIQQAKIEKLEVVAVGKSENIESVQLSVSTHKDIVKVCQKLKYEGKQLKNLTNRLVELFQT… |
| A0A7C4J4V2 | 4-139 | None |
| A0A7V4KHB3 | 9-136 | None |
| A0A1V5K048 | 56-215 | None |
| M3G329 | 4-148 | None |
| M6TCG8 | 12-168 | None |
| A0A1C0AAP1 | 26-164 | None |
| A0A522CMX7 | 4-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.